Sukses

Terkuak, 30 Ribu Huruf RNA yang Terdapat pada Varian Virus Corona B117

Liputan6.com, Inggris - Setiap Virus Corona memiliki genom sebagai intinya. Genom tersebut terdiri dari untaian memutar dari hampir 30.000 huruf RNA yang menginstruksikan alias memaksa sel manusia yang terinfeksi untuk mengumpulkan hingga 29 jenis protein yang membantu virus penyebab COVID-19 berkembang biak dan menyebar.

Saat virus mereplikasi, bisa saja terjadi kesalahan penyalinan, meskipun kecil, yang kita sebut sebagai mutasi yang secara alami muncul dalam genomnya. Garis keturunan Virus Corona biasanya akan mengakumulasi satu atau dua mutasi acak setiap bulan.

Mutasi tersebut bisa tidak berpengaruh pada protein Virus Corona, bisa juga mutasi lainnya mengubah bentuk protein dengan mengubah atau menghapus salah satu asam aminonya, yaitu bahan penyusun yang terhubung bersama untuk membentuk protein.

Melalui proses seleksi alam, mutasi netral atau yang sedikit beruntung dapat diwariskan dari generasi ke generasi, sementara mutasi yang merugikan kemungkinan besar akan punah.

Mutasi Dalam Silsilah B.1.1.7

Menurut Pusat Pengendalian dan Pencegahan Penyakit (CDC), varian Virus Corona yang pertama kali dilaporkan di Inggris memiliki 17 mutasi terbaru yang mengubah atau menghapus asam amino dalam protein virus. Varian tersebut dinamai Variant of Concern 202012/01 oleh Public Health England, dan merupakan bagian dari garis keturunan virus corona B.1.1.7.

Beberapa mutasi penting dalam garis keturunan B.1.1.7 adalah sebagai berikut, dengan enam mutasi yang tidak mengubah asam amino, dilansir dari NYTimes.

1. Eight Spike Mutations (delapan mutasi spike protein)

Jenis ini sangat mengkhawatirkan para peneliti dengan delapan mutasi B.1.1.7 yang mengubah bentuk spike Virus Corona, yang digunakan virus untuk menempel pada sel dan menyelinap ke dalam.

Setiap spike terdiri dari sekelompok tiga protein yang saling terkait. Sebuah spike protein biasanya membutuhkan 1.273 asam amino, yang dapat ditulis seperti ini, dilansir dari Ward Lab, Scripps Research:

MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT

Sementara spike protein dalam garis keturunan B.1.1.7 memiliki dua penghapusan dan enam substitusi dalam urutan asam amino ini, yang jika ditulis sebagai huruf, spike protein B.1.1.7 akan terlihat seperti ini:

MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAI[Deletion]SGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGV[Deletion]YHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPT[Y]GVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDI[D]DTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNS[H]RRARSVASQSIIAYTMSLGAENSVAYSNNSIAIP[I]NFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDIL[A]RLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITT[H]NTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT

Mutasi Virus Corona ini mengubah bentuk spike protein dengan mengubah bentuk asam amino menjadi bentuk yang kompleks.

 

2 dari 5 halaman

2. Spike N501Y Mutation (Mutasi Spike N501Y)

Para ilmuwan menduga bahwa satu mutasi, yang disebut N501Y, sangat penting dalam membuat virus corona B.1.1.7 lebih menular. Diberi nama demikian karena mengacu pada sifat perubahannya, yaitu asam amino ke-501 dalam spike protein dari yang awalnya N (asparagine/ASN) menjadi Y (tirosin/THY).

Mutasi N501Y mengubah asam amino di dekat bagian atas setiap spike protein, yang merupakan lokasi transaksi kontak dengan reseptor khusus pada sel manusia. Jenis mutasi ini membentuk tiga set atau lokasi spike. Kalau pada virus corona biasa, ujung spike protein seperti potongan puzzle yang tidak pas dan tetap bisa menempel pada sel manusia meskipun agak longgar, sehingga virus seringkali menjauh dan gagal menginfeksi sel. Sementara mutasi N501Y memiliki potongan puzzle yang lebih mulus, yang bisa menyesuaikan lebih pas dan ketat, sehingga meningkatkan keberhasilan infeksi.

Para peneliti berpikir mutasi N501Y telah berevolusi secara independen di banyak garis keturunan virus korona yang berbeda. Selain garis keturunan B.1.1.7, telah diidentifikasi dalam varian dari Australia, Brasil, Denmark, Jepang, Belanda, Afrika Selatan, Wales, Illinois, Louisiana, Ohio, dan Texas.

Selain N501Y, B.1.1.7 memiliki 16 mutasi lain yang mungkin menguntungkan virus dengan cara lain. Mungkin juga mereka mutasi netral, yang tidak memiliki efek apa pun (yang netral mungkin hanya sekedar diturunkan dari generasi ke generasi). karena ketidak-jelasan yang mengkhawatirkan ini, sehingga para ilmuwan masih terus bereksperimen untuk mencari tahu apa yang terjadi ada setiap mutasi.

3. Spike H69–V70 Deletion (Penghapusan Spike H69-V70)

Satu mutasi masih misterius dalam garis keturunan B.1.1.7, yaitu yang menghapus asam amino ke-69 dan ke-70 dalam spike protein. Berdasarkan eksperimen peneliti, penghapusan ini kemungkinan meningkatkan keberhasilan virus korona dalam menginfeksi sel, yang kemungkinan caranya dengan membuat antibodi lebih sulit untuk menempel.

Para peneliti menyebut ini sebagai wilayah penghapusan berulang karena bagian genom yang sama telah berulang kali dihapus dari garis keturunan virus corona yang berbeda. Penghapusan H69 – V70 juga terjadi pada varian yang menginfeksi jutaan cerpelai di Denmark dan negara lain. Para ilmuwan mulai mengidentifikasi sejumlah kawasan ini, yang mungkin memainkan peran penting dalam evolusi virus di masa depan.

4. Spike Y144/145 Deletion (Penghapusan Spike Y144 / 145)

Wilayah lain yang mengalami penghapusan berulang yaitu pada asam amino ke-144 atau 145 dalam spike protein. Nama mutasi berasal dari dua tirosin ( Y ) yang biasanya berada pada posisi tersebut dalam protein. Seperti penghapusan H69–V70, penghapusan Y144/145 juga terjadi di tepi ujung spike. Mutasi ini juga dapat mempersulit antibodi untuk menempel pada virus corona.

5. Mutasi Spike P681H

Mutasi ini mengubah asam amino dari P menjadi H pada batang spike virus korona. Saat spike protein berkumpul di permukaan virus corona, mereka belum siap untuk menempel pada sel. Enzim manusia pertama-tama harus memotong satu bagian batang spike. Mutasi P681H dapat mempermudah enzim untuk mencapai tempat yang perlu dipotong.

Seperti N501Y, mutasi P681H telah muncul di garis keturunan virus korona selain B.1.1.7. Tetapi jarang ada satu garis keturunan yang membawa kedua mutasi tersebut.

 

3 dari 5 halaman

6. Mutasi ORF8 Q27stop

ORF8 adalah protein kecil yang fungsinya masih misterius. Dalam satu percobaan, para ilmuwan menghapus protein tersebut dan menemukan bahwa virus corona masih bisa menyebar. Itu menunjukkan bahwa ORF8 tidak memerlukan replikasi, tetapi mungkin masih unggul dan lebih kompetitif atas mutan yang telah kehilangan protein. ORF8 biasanya hanya terdiri dari 121 asam amino seperti yang digambarkan oleh Yang Zhang Research Group, University of Michigan berikut ini:

MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Tetapi mutasi B.1.1.7 mengubah asam amino ke-27 dari Q menjadi tanda [stop] genetik. Ketika sel yang terinfeksi membangun protein ORF8, ia berhenti pada mutasi ini dan hanya menyisakan 26 asam amino seperti berikut ini:

MKFLVFLGIITTVAAFHQECSLQSCT [Stop]

Peneliti berasumsi bahwa bungkamnya ORF8 ini membuatnya tidak lagi berfungsi. Tetapi asumsi lainnya, jikalaupun B.1.1.7 dirugikan atas kehilangan proteinnya, kemungkinan hal ini dapat tertutupi oleh keuntungan dari mutasi lain seperti N501Y. Hal ini terbukti dari kemunculan dua mutasi B.1.1.7 lainnya di ORF8 setelah tanda [Stop], mengubah R ke I dan Y ke C, seperti dijabarkan berikut ini.

HQPYVVDDPCPIHFYSKWYIRVGA [I] KSAPLIELCVDEAGSKSPIQ [C] IDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Karena protein ORF8 dipotong pendek, kedua mutasi ini mungkin tidak berpengaruh apa-apa.

Deteksi dan Penyebaran

B.1.1.7 pertama kali terungkap di Inggris Raya pada akhir November . Para peneliti melihat kembali sampel sebelumnya dan menemukan bahwa bukti pertama berasal dari 20 September, dalam sampel yang diambil dari seorang pasien di dekat London.

Garis keturunan B.1.1.7 kini telah terdeteksi di lebih dari 50 negara, termasuk Amerika Serikat, dengan setidaknya telah terdeteksi di 14 negara bagian. Inggris telah menanggapi lonjakan B.1.1.7 dengan penguncian yang ketat, dan negara lain telah mencoba mencegah penyebarannya dengan pembatasan perjalanan. Sementara AS tidak memiliki programm pengawasan nasional untuk menentukan tingkat penyebarannya secara menyeluruh.

B.1.1.7 diperkirakan kira - kira 50 persen lebih dapat ditularkan dibandingkan varian lain. Pejabat kesehatan federal memperingatkan bahwa itu mungkin menjadi varian dominan di Amerika Serikat pada Maret. Meskipun tidak lebih mematikan daripada bentuk lain dari virus korona, namun karena lebih menginfeksi sehingga bisa menyebabkan lebih banyak kematian.

Bagaimana Varian Berkembang?

Sejumlah peneliti menduga B.1.1.7 memperoleh banyak mutasi dalam satu orang, yaitu orang yang memiliki sistem kekebalan yang lemah. Karena pada orang tersebut replikasi virus korona akan tetap aktif selama beberapa bulan, memungkinkan virus untuk mengakumulasi banyak nutrisi tambahan.

Kemudian, jika pasien ini dirawat dengan plasma dari penyintas lainnya yang mengandung antibodi virus korona, seleksi alam mungkin menyukai virus yang telah bermutasi dan membiarkan mereka lolos dari serangan. Setelah garis keturunan B.1.1.7 telah cukup kuat pasukannya maka ia dapat menyebar lebih cepat dari orang ke orang.

Mutasi lain yang masih ditinjau

Salah satu mutasi pertama yang menimbulkan kekhawatiran di kalangan ilmuwan dikenal sebagai D614G . Itu muncul di China pada awal pandemi dan mungkin telah membantu virus menyebar lebih mudah . Di banyak negara, garis keturunan D614G mendominasi populasi virus corona. B.1.1.7 merupakan turunan dari garis keturunan D614G.

Varian yang lebih baru terdeteksi di Afrika Selatan dengan cepat menyebar ke beberapa negara lain. Ia dikenal sebagai 501Y.V2 dan merupakan bagian dari garis keturunan B.1.351. Varian ini memiliki 'delapan mutasi spike' (yang disebutkan di atas) yang mengubah asam amino pada protein spike. Di antara mutasi ini adalah N501Y, yang membantu spike menempel lebih erat ke sel manusia.

Harapan para peneliti semoga tak satupun dari varian mutasi ini dapat membantu virus korona lolos dari vaksin yang telah lolos uji coba. Antibodi yang dihasilkan oleh vaksin Pfizer-BioNTech diklaim mampu mengunci spike virus korona yang memiliki mutasi spike N501Y, sehingga tidak bisa berikatan dengan reseptor pada manusia yang telah divaksin oleh vaksin tersebut.

Para ahli menekankan bahwa kemungkinan akan memakan waktu bertahun-tahun, dan lebih banyak lagi mutasi, agar virus cukup berkembang untuk menghindari vaksin saat ini.

4 dari 5 halaman

Infografis Varian Baru Virus Corona Hantui Inggris.

5 dari 5 halaman

Simak Video Berikut Ini: